l carnitine 1000mg injection Injection, 1000 mg at ₹ 318/unit in Nagpur CARNITOR ®(levocarnitine) Injection 1 g

Read our full vote coverage

2460055-10-9 Appearance Solid Molecular Weight 5358.06 Formula C 228 H 388 N 86 O 64 Color White to off-white Sequence D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly) Sequence Shortening D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) Shipping Room temperature in continental US

Our goal is to help you move beyond the label and understand the biology of what makes a supplement effective

Vitamin E 50mg

Preclinical toxicological data: Acute and subacute toxicity studies in rats did not reveal any mortality or significant organ toxicity, even at doses well above therapeutic doses (up to 100 times the effective dose)